PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000308617
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 544aa    MW: 58994 Da    PI: 7.3844
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000308617genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.23.7e-184491148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ed+ lv++v+++G g+W+++ r  g++R++k+c++rw ++l
    MDP0000308617 44 KGPWTAAEDQVLVEYVRKHGEGNWNSVQRNSGLNRCGKSCRLRWANHL 91
                     79******************************************9986 PP

2Myb_DNA-binding48.32.3e-1597140146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g+++++E+ l++++++++G++ W++ a+ ++ gRt++++k++w++
    MDP0000308617  97 KGSFSPDEERLILELHAKYGNK-WARMASQLP-GRTDNEIKNYWNT 140
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.5E-233994IPR009057Homeodomain-like
PROSITE profilePS5129419.123991IPR017930Myb domain
SuperFamilySSF466893.56E-3141138IPR009057Homeodomain-like
SMARTSM007172.2E-154393IPR001005SANT/Myb domain
PfamPF002491.1E-154491IPR001005SANT/Myb domain
CDDcd001671.33E-114691No hitNo description
PROSITE profilePS5129425.3792146IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.7E-2595145IPR009057Homeodomain-like
SMARTSM007171.4E-1696144IPR001005SANT/Myb domain
PfamPF002498.9E-1597140IPR001005SANT/Myb domain
CDDcd001675.12E-1299140No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 544 aa     Download sequence    Send to blast
MTPNSNDGIN INGCSVLQSQ ELLESRGGDG GGGLVVVGSK GLKKGPWTAA EDQVLVEYVR  60
KHGEGNWNSV QRNSGLNRCG KSCRLRWANH LRPNLKKGSF SPDEERLILE LHAKYGNKWA  120
RMASQLPGRT DNEIKNYWNT RVKRRQRQGL PLYPHDIKQS QYPYSHSHSP PTSLTIPNGV  180
LNPPTTPTXN SLHPNTHNSP SPSFCFQIQS PTQTHHHPHI PPLSPTPPSL SPLSSPHQPK  240
PTSATSLPLF DPTATASTPS FTFHRPAPIL GAPLSHKRYR DSVGYSPPIS PAPQRITSIL  300
RTSSMPDIAS FQLTAAGTST MPDMSSFQFP RTFNNPFPPM SRTQFEYSDG LLSPSGSVYS  360
VKSELPSNQV SQTHSEVTIE AKVSSTVAAV SAADENNGLL ENLLQEAEAL AXGGSGGGGN  420
NNSRVRGNGM LGSFDEKQVS DGYGRWLQST TSMGSSLFEA KPIHDDHLNS MPEDLSKLFS  480
FIPSTEPVSD WYSDSGELSN GHSSGLTDTS LDFDMQHMAS LFPVTATGEH GRASSSWDNL  540
PGIC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-32381451107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008385966.10.0PREDICTED: transcription factor MYB86-like
TrEMBLM5X4J11e-173M5X4J1_PRUPE; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.13e-67myb domain protein 101